Skip to content
Campus Alert Archive
Tulane

Rideshare driver allegedly threatens a student with a knife in an attempted robbery

AI-generated · every claim is source-linked
LArobberytimely warninghigh confidence
Confirmed Threat

On August 29, 2024, a group of Tulane students returning to campus via Uber were targeted in an attempted armed robbery at Willow Street and McAlister Drive at approximately 11:40 PM CDT. The rideshare driver allegedly pointed a knife at one student and demanded more money after the other passengers had exited. The victim escaped the vehicle without injuries, and NOPD identified a suspect.

Alerts
1
Response
Killed
0
Injured
0
Institution
Tulane University
Private R1 · LA
All Tulane cases →
~14,000 studentsTU Alerts
Official alert policy
Read when and how Tulane says it will use TU Alert (Everbridge): summarized, quoted, and analyzed.
Documented Timeline

Alert Sequence

1 message in sequence · 1 verified verbatim

Confirmed wording is transcribed character-for-character from a primary source. Use Verify this quote under each message to open that source in a new tab and compare the text yourself.

INITIAL ALERTEmail
Verified verbatim545 chars
Timely Warning — Attempted Armed Robbery (Uptown Campus) Around 11:40 p.m. on August 29, a group of students used an Uber to return to campus at Willow Street and McAlister Drive. The victim's friends got out of the car at their drop-off location when the driver allegedly pointed a knife at the victim and demanded more money for the trip. The victim left the car without injuries, and the driver left the scene. NOPD has identified a suspect. If you have any information about these crimes, call TUPD at 504-865-5381 or NOPD at 504-821-2222.
Verbatim narrative recovered from TUPD's timely warning via WWL-TV's quoted reporting (wwltv.com/article/news/crime/tulane-police-attempted-armed-robbery-on-uptown-campus-new-orleans)
The incident occurred during the first week of the fall 2024 semester
The robbery attempt occurred at Willow Street and McAlister Drive, which is on the Tulane Uptown campus near McAlister Auditorium
The alleged perpetrator was the rideshare driver, making this an unusual case of a service provider targeting a student
Message elements

How the first alert is built

To check this alert, Claude (an AI) read it in full 25 separate times, independently. Each read decided whether the message answers each of the six questions and gave a short reason. A final reviewer then weighed all 25 and wrote the plain-English verdict you see when you open a row. The score (for example 22/25) is how many reads agreed; the 25 individual reads are tucked underneath if you want to check them.

Timely Warning — Attempted Armed Robbery (Uptown Campus) Around 11:40 p.m. on August 29, a group of students used an Uber to return to campus at Willow Street and McAlister Drive. The victim's friends got out of the car at their drop-off location when the driver allegedly pointed a knife at the victim and demanded more money for the trip. The victim left the car without injuries, and the driver left the scene. NOPD has identified a suspect. If you have any information about these crimes, call TUPD at 504-865-5381 or NOPD at 504-821-2222.

  • Sourcepresent25/25

    Final assessment

    Unanimous that the source is present, naming the issuing campus authority.

    Who is sending the alert and who is responding. People act faster on a message from a clearly identifiable, credible sender, such as a named department, the police, or a branded alert system, than on an anonymous notice. A branded signature counts.

    See all 25 individual reads
    1. present: References "TUPD", a named campus police authority.
    2. present: Identifies sender via "TUPD" and the "Timely Warning" from Tulane.
    3. present: Opens "Timely Warning" and names "TUPD" and "NOPD", identifying the sender.
    4. present: Names "TUPD" and "NOPD" as contacts and issues a "Timely Warning", identifying the source.
    5. present: Opens with "Timely Warning" and names "TUPD" (Tulane) as a contact authority.
    6. present: Branded "Timely Warning" with contacts to "TUPD" identifying Tulane University Police.
    7. present: Names "TUPD" and "NOPD" and opens "Timely Warning", identifying the sender.
    8. present: Headed "Timely Warning" referencing "TUPD", the issuing authority.
    9. present: Opens with "Timely Warning" and names "TUPD", the Tulane police, as the source.
    10. present: Identifies "TUPD" and "NOPD" as authorities and "(Uptown Campus)" as the issuer's campus.
    11. present: Branded "Timely Warning" plus contacts for "TUPD" identify the source.
    12. present: Names "TUPD" and "NOPD" as the relevant police authorities.
    13. present: Identifies "TUPD" via the contact number as the issuing authority.
    14. present: Opens with "Timely Warning" and references "TUPD", identifying the sender.
    15. present: References "TUPD", identifying Tulane University Police as a contact authority.
    16. present: Names "TUPD" and "NOPD", identifying the issuing campus authority.
    17. present: Identifies sender via "TUPD" and the "Timely Warning" referencing the Uptown Campus.
    18. present: References "TUPD" in the contact line, identifying the campus police source.
    19. present: Tells recipients to "call TUPD" and references "NOPD", identifying issuing and partner authorities.
    20. present: Identifies "TUPD" and "NOPD" as named authorities and signs "Timely Warning".
    21. present: Identifies "TUPD" and "NOPD" as contacts and the issuing authority for the "Timely Warning".
    22. present: Headed "Timely Warning" and references "TUPD", identifying the sender.
    23. present: The message names "TUPD", identifying the sender via the Tulane police acronym.
    24. present: It references "TUPD" and "NOPD", identifying the issuing police authorities.
    25. present: Opens with "Timely Warning" and lists "TUPD" as the contact, identifying the source.
  • Hazardpresent25/25

    Final assessment

    All 25 reads agree the hazard is stated, describing a robbery attempt.

    What the threat actually is. A complete warning names the specific danger, such as a shooter, a fire, a tornado, or a gas leak, rather than a vague emergency, because people decide what to do based on what they are facing.

    See all 25 individual reads
    1. present: Names the specific hazard "Attempted Armed Robbery" with a knife.
    2. present: Names the hazard, "Attempted Armed Robbery" with a driver who "pointed a knife".
    3. present: It names an "Attempted Armed Robbery" with a knife, a specific threat.
    4. present: It names "Attempted Armed Robbery" with a knife, a specific hazard.
    5. present: Names "Attempted Armed Robbery" with a driver who "pointed a knife", a specific crime.
    6. present: Names the specific crime "Attempted Armed Robbery" involving a knife.
    7. present: Names "Attempted Armed Robbery" involving a knife, a specific crime.
    8. present: Names "Attempted Armed Robbery" involving a knife, a specific threat.
    9. present: Names the specific hazard "Attempted Armed Robbery" where a driver "pointed a knife at the victim".
    10. present: Names the specific threat "Attempted Armed Robbery" with a knife.
    11. present: Names the hazard "Attempted Armed Robbery" with a knife.
    12. present: Names the hazard as an "Attempted Armed Robbery" with a knife.
    13. present: Names the specific hazard "Attempted Armed Robbery" with a "knife".
    14. present: Names the hazard as an "Attempted Armed Robbery" involving a knife.
    15. present: Names the hazard as an "Attempted Armed Robbery" with a knife.
    16. present: Names the hazard as an "Attempted Armed Robbery" with a knife.
    17. present: Names the hazard as an "Attempted Armed Robbery" with a driver who "pointed a knife".
    18. present: Names "Attempted Armed Robbery" with a driver who "pointed a knife", a specific threat.
    19. present: Names an "Attempted Armed Robbery" with a knife, a specific threat.
    20. present: Names the hazard, an "Attempted Armed Robbery" with a driver who "pointed a knife".
    21. present: Names the hazard as "Attempted Armed Robbery" involving a knife.
    22. present: Names "Attempted Armed Robbery" with a knife, a specific crime threat.
    23. present: It names a specific threat, "Attempted Armed Robbery" with a driver who "pointed a knife".
    24. present: It names an "Attempted Armed Robbery" involving a knife, a specific threat.
    25. present: Names the hazard, an "Attempted Armed Robbery" involving a knife.
  • Locationpresent25/25

    Final assessment

    Unanimous that a specific location is given for the incident.

    Where the threat is. Saying whether danger is in a specific building, a part of campus, or area-wide lets people judge their own proximity and choose a safe direction. Without a where, a warning is hard to act on precisely.

    See all 25 individual reads
    1. present: Specifies "Willow Street and McAlister Drive" on "Uptown Campus".
    2. present: Gives location, "campus at Willow Street and McAlister Drive".
    3. present: It locates it "at Willow Street and McAlister Drive" on the "Uptown Campus", a specific place.
    4. present: It specifies "campus at Willow Street and McAlister Drive" on the "Uptown Campus".
    5. present: Specifies "Willow Street and McAlister Drive" on the "Uptown Campus".
    6. present: Specifies "Willow Street and McAlister Drive" on the Uptown Campus.
    7. present: Specifies "campus at Willow Street and McAlister Drive (Uptown Campus)".
    8. present: Specifies "campus at Willow Street and McAlister Drive (Uptown Campus)", a location.
    9. present: Specifies "campus at Willow Street and McAlister Drive (Uptown Campus)".
    10. present: Specifies "campus at Willow Street and McAlister Drive".
    11. present: Locates it "at Willow Street and McAlister Drive" on the Uptown Campus.
    12. present: Locates it "at Willow Street and McAlister Drive" on the "Uptown Campus".
    13. present: Specifies "campus at Willow Street and McAlister Drive".
    14. present: Specifies "campus at Willow Street and McAlister Drive".
    15. present: Locates it on campus "at Willow Street and McAlister Drive".
    16. present: States location: "Willow Street and McAlister Drive" on the "Uptown Campus".
    17. present: Gives location "campus at Willow Street and McAlister Drive".
    18. present: Specifies "Willow Street and McAlister Drive" on the "Uptown Campus".
    19. present: Locates it "at Willow Street and McAlister Drive" on the "Uptown Campus".
    20. present: Specifies "campus at Willow Street and McAlister Drive".
    21. present: Locates it on "campus at Willow Street and McAlister Drive".
    22. present: Specifies "Willow Street and McAlister Drive" on the "Uptown Campus".
    23. present: It locates it "at Willow Street and McAlister Drive", on the Uptown Campus.
    24. present: It specifies "Willow Street and McAlister Drive" on the "Uptown Campus".
    25. present: States the location, "Willow Street and McAlister Drive" on the Uptown Campus.
  • Guidanceabsent10/25

    Final assessment

    A majority finds no protective action to recipients; asking those with information to call TUPD or NOPD is a tip request, not guidance.

    The protective action to take. A clear, specific instruction, such as shelter in place, evacuate, avoid the area, or run-hide-fight, drives faster and more correct protective behavior than describing the threat alone.

    See all 25 individual reads
    1. absent: No protective action directed to recipients; only asks those with information to call police.
    2. absent: Gives only a contact-with-information request, no protective action to recipients.
    3. present: It instructs those with information to "call TUPD" or "NOPD", the directed action provided.
    4. absent: NOPD identified a suspect; only an information request is made, no protective action to recipients.
    5. absent: Asks only those with information to call TUPD or NOPD; no protective action for recipients.
    6. absent: Only asks those with information to call; no protective action is directed at recipients.
    7. present: Asks anyone with information to "call TUPD" or "NOPD", an instruction to recipients.
    8. present: Asks anyone with information to "call TUPD ... or NOPD", an action to take.
    9. present: Directs anyone with information to "call TUPD" or "NOPD", the instructed action.
    10. present: Instructs anyone with information to "call TUPD" or "NOPD", a directed action.
    11. present: Instructs anyone with information to "call TUPD" or "NOPD", an action.
    12. absent: Asks for information but gives no protective action to recipients.
    13. absent: Asks only for information; gives no protective action instruction to recipients.
    14. present: Instructs recipients with information to "call TUPD" or "NOPD", a reporting action.
    15. absent: Only asks those with information to call police, no protective action for recipients.
    16. present: Instructs those with information to "call TUPD" or "NOPD".
    17. absent: No protective action instructed; only asks anyone with information to call police.
    18. absent: Only asks those with information to call police, no protective action given.
    19. present: Asks anyone with information to "call TUPD" or "NOPD", a reporting action to recipients.
    20. present: Instructs those with information to "call TUPD" or "NOPD".
    21. absent: No protective action is directed to recipients; it only asks for information about the crime.
    22. absent: Asks only those with information to call, not a protective action.
    23. absent: It only asks those with information to call police; no protective action is instructed to recipients.
    24. absent: It only asks for information and gives no protective action instruction to recipients.
    25. absent: The text asks those with information to call but gives no protective action for safety.
  • Timepresent25/25

    Final assessment

    All 25 reads agree timing is present, with a clock time or recency cue.

    When the message applies. A timestamp, the word now or immediately, or a phrase like until further notice tells the reader whether the danger is current and how quickly to act.

    See all 25 individual reads
    1. present: Gives the time "Around 11:40 p.m. on August 29".
    2. present: Gives a time, "Around 11:40 p.m. on August 29".
    3. present: It gives "Around 11:40 p.m. on August 29", a clock time and date.
    4. present: It gives "Around 11:40 p.m. on August 29", a clock time and date.
    5. present: States "Around 11:40 p.m. on August 29", a clock time and date.
    6. present: States "Around 11:40 p.m. on August 29".
    7. present: Gives "Around 11:40 p.m. on August 29", a time and date.
    8. present: Says "Around 11:40 p.m. on August 29", a clock time and date.
    9. present: Gives the time "Around 11:40 p.m. on August 29".
    10. present: Gives "Around 11:40 p.m. on August 29".
    11. present: Gives time and date "Around 11:40 p.m. on August 29".
    12. present: Gives "Around 11:40 p.m. on August 29".
    13. present: Gives the time "Around 11:40 p.m. on August 29".
    14. present: Gives time and date, "Around 11:40 p.m. on August 29".
    15. present: Gives "Around 11:40 p.m. on August 29".
    16. present: Gives time and date: "Around 11:40 p.m. on August 29".
    17. present: Gives time "Around 11:40 p.m. on August 29".
    18. present: Gives "Around 11:40 p.m. on August 29", a specific time.
    19. present: Gives "Around 11:40 p.m. on August 29", a clock time and date.
    20. present: Gives timing, "Around 11:40 p.m. on August 29".
    21. present: Gives time "Around 11:40 p.m. on August 29".
    22. present: Says "Around 11:40 p.m. on August 29", a specific time.
    23. present: It gives a specific time and date, "Around 11:40 p.m. on August 29".
    24. present: It gives the time "Around 11:40 p.m. on August 29".
    25. present: Gives the time and date, "Around 11:40 p.m. on August 29".
  • Impactpresent25/25

    Final assessment

    Present, unanimous. Reads agree the alert reports a robbery attempt involving a victim, a stated harm or danger to a person.

    What the hazard could do to the people in its path. Beyond naming the threat, a complete warning conveys its potential consequences or severity, such as that a tornado can level buildings or that a leak could be explosive, so recipients grasp how much danger they are in. Research on warning message content finds that a concrete impact statement helps people personalize their risk and act sooner.

    See all 25 individual reads
    1. present: Describes a knife pointed at a victim during an attempted armed robbery, a clear threat of harm.
    2. present: Describes an attempted armed robbery with a knife pointed at the victim, a stated threat of harm.
    3. present: Reports a knife pointed at a victim during a robbery, conveying a threat of harm though victim was uninjured.
    4. present: It describes an attempted armed robbery where a driver pointed a knife at the victim, a clear stated danger to a person.
    5. present: Describes an attempted armed robbery with a knife pointed at the victim, conveying a clear danger though the victim left uninjured.
    6. present: Describes an attempted armed robbery with a knife pointed at the victim, conveying threatened harm though victim left uninjured.
    7. present: It describes a knife pointed at the victim and notes the victim left without injuries, conveying the threatened harm.
    8. present: A driver pointed a knife at the victim and demanded money, a clearly stated threat of harm.
    9. present: Describes a knife pointed at a victim during a robbery attempt, an explicitly stated danger.
    10. present: Describes a knife pointed at a victim during an attempted robbery, conveying a threat of harm though victim left uninjured.
    11. present: It describes a driver pointing a knife at a victim and notes the victim left without injuries, conveying a threat of harm.
    12. present: It describes a knife pointed at a victim during an attempted armed robbery, though the victim left without injuries, conveying a threat of harm.
    13. present: It describes an attempted armed robbery with a knife pointed at the victim, an implied threat of harm, though it notes the victim was uninjured.
    14. present: It describes an attempted armed robbery with a knife pointed at the victim, an explicit threat of harm though victim left uninjured.
    15. present: Describes an attempted armed robbery with a knife pointed at the victim, an implied threat of harm.
    16. present: Describes a knife pointed at a victim during an attempted armed robbery, a clearly stated danger though victim was uninjured.
    17. present: It describes an attempted armed robbery where a driver pointed a knife and demanded money, a stated threat of harm.
    18. present: It describes an attempted armed robbery in which a driver pointed a knife at a victim, a stated danger.
    19. present: It describes a knife pointed at the victim during a robbery, though it notes the victim left without injuries, conveying a threat of harm.
    20. present: Describes a driver pointing a knife at a victim and demanding money, a stated threat though the victim was uninjured.
    21. present: It describes a driver pointing a knife at the victim and demanding money, a stated threat of harm though the victim left uninjured.
    22. present: It describes a driver pointing a knife at the victim during an attempted armed robbery, implying a threat of harm, and notes the victim left without injuries.
    23. present: Describes a knife pointed at the victim and notes the victim left without injuries, conveying threat and harm status.
    24. present: It describes an attempted armed robbery with a knife pointed at a victim, a stated threat of harm though victim left uninjured.
    25. present: It describes an attempted armed robbery in which a driver pointed a knife at the victim, a stated threat of harm.

Systematic AI judgments with visible reasoning, not human-validated codings.

About this analysis
Context

Background

On the evening of August 29, 2024, during the first week of Tulane's fall semester, a group of students used an Uber to return to the Uptown campus. At Willow Street and McAlister Drive, the other passengers exited the vehicle, and the driver allegedly pointed a knife at the remaining student and demanded additional money for the trip. The victim managed to leave the car without injuries, and the driver fled the scene. TUPD issued a timely warning to the campus community and notified the New Orleans Police Department, which identified a suspect. The incident highlighted ongoing safety concerns around rideshare usage in the New Orleans area near campus. Tulane had previously dealt with armed robberies of students near campus, including multiple incidents involving students walking near the Uptown campus perimeter.
Analysis

Key Findings

The perpetrator was the rideshare driver, an unusual scenario that raises questions about student safety when using ride-hailing services
The incident occurred during the first week of the fall 2024 semester, when many students are new to the area
NOPD identified a suspect in connection with the incident
Outcome
The victim escaped the vehicle without physical injuries. The driver fled the scene. NOPD identified a suspect in connection with the incident. Tulane University Police Department issued a timely warning to the campus community.
Provenance

Sources

Every claim on this page is meant to be checkable. Open the links below (and the Verify this quote control under each confirmed alert) to read the original university, news, or archive page yourself. Hostnames are shown so you can see where you are going; archived copies survive when live pages move or disappear. See also our methodology.

  1. News
  2. Official
  3. Student Paper
Cite this case

Campus Alert Archive. "Tulane University: Rideshare driver allegedly threatens a student with a knife in an attempted robbery." Incident of August 29, 2024. Added May 2026; last updated July 2026. https://campusalertarchive.com/case/tulane-university-robbery-attempt-2024-08-29/

Download case JSON

Alert text quoted on this page remains the work of the issuing institution; the archive is a secondary source.

Tags
robberyattempted-robberyrideshareknifetimely-warninglouisianaprivate-university
Added May 2026Updated July 2026Via ingestion